Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00765.1.g00190.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 249aa    MW: 26674.9 Da    PI: 8.8265
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                                   +++r +r++kNRe+A rsR+RK+a++ eLe++vk L++eN++L+ + e+l+ 176 SDRRKKRMIKNRESAARSRARKQAYVRELEKEVKLLQQENQSLRVKYEQLRV 227
                                   689******************************************9999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-13174243IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.99176226IPR004827Basic-leucine zipper domain
PfamPF001702.3E-15177228IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-12178227No hitNo description
Gene3DG3DSA: hitNo description
CDDcd147073.77E-22178225No hitNo description
PROSITE patternPS000360181196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957504.15e-80PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLK3ZWU55e-80K3ZWU5_SETIT; Uncharacterized protein
STRINGSi031077m1e-79(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number